Follow Binomial lab on F6S

Free to use bioinformatics server is an open source,
web-based platform for data intensive biomedical research
Data platform: 2D protein sequence
web tools for the prediction of various structural features of proteins based on the protein sequence
Data platform: 2D RNA prediction
Machine learning for RNA 2D structure prediction
Data platform: 3D dimer
Bioinformatics Analysis Platform: Get 3D dimer physical properties: Input files-Download Data
Data platform: 2D temperature correction method for proteins
Protein Thermostability Calculations
Data platform:3D peptide calculations
Strategies for Improving Peptide Stability . The possible solutions to enhance the stability of peptides.
Data platform: 2D Protein phosphorylation
Protein Phosphorylation: Mechanisms, Types
Data platform: 3D Antibody-Anrigen
A deep learning method for predicting antibody-antigen interactions based on sequence information
Data platform: 3D monomer
Predicting the Effects of Single Mutations on Protein Stability
machine learning
Bioinformatics Analysis Platform: machine learning
antibody antigen, bioinformatics, flexible chains
p53, bioinformatics, flexible chains
New! AI and Machine learning
for computational biochemistry:
Protein
Monomer
Dimer
Monomer+Inhibitor+atom
soft and lectures
peptide stability (Aggregation kinetics)
Antibody-Antigen
Target protein+Fab2
RNA molecules
2D and 3D molecules
Stability,
entropy change,
enthalpy,
dissociation energy,
Gibbs free energy.
graphs, curves, dependencies
Examples
Online server
protein phosphorylation
peptide stability
Results: The calculation of the physical quantities of interaction characterizing the formation of each complex reveals the direction of the passage of biochemical reactions depending on the affinity and concentration of active elements, thus the platform will help determine stable and transient biological formations with the participation of the studied drugs.

Cloud, check out this in-depth deep learning video created
Link: http://biomarker.co.il/scheme2
cloud-native platform for biomedical researchers to access data, run analysis tools, and collaborate.
Get a set of calculated physical quantities for each biological complex in the biochemical cascade and build a diagram and order of interaction of biological molecules in the cell (and beyond)
Link: http://biomarker.co.il/scheme3
We will be very grateful for any possible assistance to the developers!
Tilda Publishing

Bring Your Ideas to Life

Linear docking
of organic linear molecules

To find the most stable planar regions of RNA molecules and proteins, you can either use an online server or download the software separately.
This software with examples has been published here.

2D sequence calculations.

analyzing large amounts of data
Best Computational Biology Platforms 2024
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
proteomics, metabolomics, and transcriptomics
PKSSMQIDNAPTPHNTPASVLNPSYLKNGNPV
Computational biology is a fast and increasingly growing field
First seq.
Second seq.
Read more!
Algorithm N1
Algorithm N2

Bioinformatics Resource Portal

Calculate and predict biochemical experiments online - save time and money
Saturn Cloud is a data science platform for scalable Python, R
2D scanning of RNA sections
Algorithm N3
Free
€
Entering your sequence
the cloud, quickly use Dask clusters, GPUs, deploy cloud resources to expand their data science capabilities
Phosphorylation effect
Algorithm N4
Free
€
Entering your sequence
Cloud supports use cases for single-cell analysis, high content screening, collaboration across teams, big data, and much more. Popular tools
Temperature Effect
Algorithm N5
Free
€
Entering your sequence

Calculate Molecule Properties

Online server for calculating 3D structures to determine the stability of such structures when introducing missense mutations

Monomer physical properties

Algorithm N10

Get physical data on substitutions of amino acid residues in protein
Free
€
Upload your Pdb file

Dimer physical properties

Algorithm N11

Get physical data on substitutions of amino acid residues in protein dimer
Free
€
Upload your Pdb file

Peptide Aggregation Study

Algorithm N12

Get physical data on substitutions of amino acid residues in peptides
Free
€
Upload your Pdb file

The binding strength of antibodies

Calculations for Molecular Biology and Biotechnology
Algorithm N15

Antibody-Antigen

Selection of flexible antibody chains to antigen. To find the most stable planar regions of RNA molecules and proteins, you can either use an online server or download the software separately.
This software with examples has been published here.
InPut pdb files
Algorithm N16

Monomer+Inhibitor

You can study online with our teachers at any convenient time for you. You can choose your favorite tutor from all community members, choose the necessary subjects to exercise in if you want to get intensive classes.
InPut pdb files
Algorithm N17

Monomer+Inhibitor+Inhibitor

We develop special classes for kids to start speaking new languages with fun and no fear. All kids will be involved in intellectual games and the discussion process.
InPut pdb files

Still have questions?

Here you can ask a question about your personal research specifics; perhaps you have not found the section that is suitable for you, ask a question or attach a file.
Electronic box for feedback: server@binomlabs.com
Responsible editor-in-chief in the field of mathematical physics
and machine learning:
Made on
Tilda